Dataset Information

A new Chinese species of Eostrobilops Pilsbry, 1927 with a checklist of Eostrobilops and Enteroplax Gude, 1897 species (Gastropoda, Pulmonata, Strobilopsidae).

ABSTRACT: Eostrobilopshumicolus Páll-Gergely & Hunyadi, sp. n. is described from Guangxi Province, China. It is characterized by the combination of a small shell (diameter: 2.3-2.4 mm), strongly ribbed dorsal surface, an infraparietal lamella not reaching the callus, and long basal folds. The new species is found approximately 500 and 800 km from the two nearest species Eostrobilopsinfrequens (northern Vietnam), and Eostrobilopsdiodontina (Hunan, China), respectively. A checklist of extant Eostrobilops Pilsbry, 1927 and Enteroplax Gude, 1899 species is provided. Enteroplaxyaeyamensis Habe & Chinen, 1974, Enteroplaxkanjiokuboi Minato & Tada, 1992 and Enteroplaxtaiwanica Minato & Tada, 1992 are moved to the genus Eostrobilops because of the lack of an elevated parietal callus and a peripheral thread. A map showing all Eostrobilops records is provided.

SUBMITTER: Pall-Gergely B

PROVIDER: S-EPMC4492207 | biostudies-literature | 2015

REPOSITORIES: biostudies-literature

ACCESS DATA

Publications

A new Chinese species of Eostrobilops Pilsbry, 1927 with a checklist of Eostrobilops and Enteroplax Gude, 1897 species (Gastropoda, Pulmonata, Strobilopsidae).

Páll-Gergely Barna B Hunyadi András A Asami Takahiro T

ZooKeys 20150617 508

Eostrobilopshumicolus Páll-Gergely & Hunyadi, sp. n. is described from Guangxi Province, China. It is characterized by the combination of a small shell (diameter: 2.3-2.4 mm), strongly ribbed dorsal surface, an infraparietal lamella not reaching the callus, and long basal folds. The new species is found approximately 500 and 800 km from the two nearest species Eostrobilopsinfrequens (northern Vietnam), and Eostrobilopsdiodontina (Hunan, China), respectively. A checklist of extant Eostrobilops Pi ...[more]

PMID: 26167122

Similar Datasets

Project description:Antimicrobial peptides (AMPs) are biomolecules with antimicrobial activity against a broad group of pathogens. In the past few decades, AMPs have represented an important alternative for the treatment of infectious diseases. Their isolation from natural sources has been widely investigated. In this sense, mollusks are promising organisms for the identification of AMPs given that their immune system mainly relies on innate response. In this report, we characterized the peptide fraction of the Cuban freshwater snail Pomacea poeyana (Pilsbry, 1927) and identified 37 different peptides by nanoLC-ESI-MS-MS technology. From these peptide sequences, using bioinformatic prediction tools, we discovered two potential antimicrobial peptides named Pom-1 (KCAGSIAWAIGSGLFGGAKLIKIKKYIAELGGLQ) and Pom-2 (KEIERAGQRIRDAIISAAPAVETLAQAQKIIKGG). Database search revealed that Pom-1 is a fragment of Closticin 574 previously isolated from the bacteria Clostridium tyrobutyrium, and Pom-2 is a fragment of cecropin D-like peptide first isolated from Galleria mellonella hemolymph. These sequences were chemically synthesized and evaluated against different human pathogens. Interestingly, structural predictions of both peptides in the presence of micelles showed models that comprise two alpha helices joined by a short loop. The CD spectra analysis of Pom-1 and Pom-2 in water showed for both structures a high random coil content, a certain content of α-helix and a low β-sheet content. Like other described AMPs displaying a disordered structure in water, the peptides may adopt a helical conformation in presence of bacterial membranes. In antimicrobial assays, Pom-1 demonstrated high activity against the Gram-negative bacteria Pseudomonas aeruginosa and moderate activity against Klebsiella pneumoniae and Listeria monocytogenes. Neither of the two peptides showed antifungal action. Pom-1 moderately inhibits Zika Virus infection but slightly enhances HIV-1 infectivion in vitro. The evaluation of cell toxicity on primary human macrophages did not show toxicity on THP-1 cells, although slight overall toxicity was observed in high concentrations of Pom-1. We assume that both peptides may play a key role in innate defense of P. poeyana and represent promising antimicrobial candidates for humans.

Dataset Information

A new Chinese species of Eostrobilops Pilsbry, 1927 with a checklist of Eostrobilops and Enteroplax Gude, 1897 species (Gastropoda, Pulmonata, Strobilopsidae).

Publications

A new Chinese species of Eostrobilops Pilsbry, 1927 with a checklist of Eostrobilops and Enteroplax Gude, 1897 species (Gastropoda, Pulmonata, Strobilopsidae).

Similar Datasets

OmicsDI is part of the ELIXIR infrastructure