Unknown

Dataset Information

0

A potential wound-healing-promoting peptide from salamander skin.


ABSTRACT: Although it is well known that wound healing proceeds incredibly quickly in urodele amphibians, such as newts and salamanders, little is known about skin-wound healing, and no bioactive/effector substance that contributes to wound healing has been identified from these animals. As a step toward understanding salamander wound healing and skin regeneration, a potential wound-healing-promoting peptide (tylotoin; KCVRQNNKRVCK) was identified from salamander skin of Tylototriton verrucosus. It shows comparable wound-healing-promoting ability (EC50=11.14 μg/ml) with epidermal growth factor (EGF; NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR) in a murine model of full-thickness dermal wound. Tylotoin directly enhances the motility and proliferation of keratinocytes, vascular endothelial cells, and fibroblasts, resulting in accelerated reepithelialization and granulation tissue formation in the wound site. Tylotoin also promotes the release of transforming growth factor β1 (TGF-β1) and interleukin 6 (IL-6), which are essential in the wound healing response. Gene-encoded tylotoin secreted in salamander skin is possibly an effector molecule for skin wound healing. This study may facilitate understanding of the cellular and molecular events that underlie quick wound healing in salamanders.

SUBMITTER: Mu L 

PROVIDER: S-EPMC5395725 | biostudies-literature | 2014 Sep

REPOSITORIES: biostudies-literature

altmetric image

Publications

A potential wound-healing-promoting peptide from salamander skin.

Mu Lixian L   Tang Jing J   Liu Han H   Shen Chuanbin C   Rong Mingqiang M   Zhang Zhiye Z   Lai Ren R  

FASEB journal : official publication of the Federation of American Societies for Experimental Biology 20140527 9


Although it is well known that wound healing proceeds incredibly quickly in urodele amphibians, such as newts and salamanders, little is known about skin-wound healing, and no bioactive/effector substance that contributes to wound healing has been identified from these animals. As a step toward understanding salamander wound healing and skin regeneration, a potential wound-healing-promoting peptide (tylotoin; KCVRQNNKRVCK) was identified from salamander skin of Tylototriton verrucosus. It shows  ...[more]

Similar Datasets

| S-EPMC9044828 | biostudies-literature
| S-EPMC7427034 | biostudies-literature
| S-EPMC10178616 | biostudies-literature
| S-EPMC4777299 | biostudies-literature
| S-EPMC6332800 | biostudies-literature
| S-EPMC6420149 | biostudies-literature
| S-EPMC8201146 | biostudies-literature
| S-EPMC10375744 | biostudies-literature
2022-05-20 | PXD029881 | Pride
| S-EPMC5772731 | biostudies-literature