Dataset Information

A global assessment of freshwater mollusk shell oxygen isotope signatures and their relation to precipitation and stream water.

ABSTRACT: Records of ?¹⁸O in stream flow are critical for understanding and modeling hydrological, ecological, biogeochemical and atmospheric processes. However, the number of such records are extremely limited globally and the length of such time series are usually less than a decade. This situation severely handicaps their use in model testing and evaluation. Here we present a global assessment of freshwater mollusk (bivalves & gastropods) isotope data from 25 river basins that have stream water isotope values, water temperature data and shell material isotope signatures. Our data span a latitude range of 37.50°S to 52.06°N. We show that ?¹⁸O signatures in freshwater mollusks are able to explain 95% of the variance of stream water ?¹⁸O. We use shell ?¹⁸O values and water temperature data to reconstruct stream water ?¹⁸O signatures. With freshwater mussel life expectancy ranging from a few years up to 200 years, this translation of mollusk metabolic properties into long term stream water isotope records is a promising approach for substantially extending global stream water isotope records in time and space.

SUBMITTER: Pfister L

PROVIDER: S-EPMC6416266 | biostudies-literature | 2019 Mar

REPOSITORIES: biostudies-literature

ACCESS DATA

Publications

A global assessment of freshwater mollusk shell oxygen isotope signatures and their relation to precipitation and stream water.

Pfister L L Grave C C Beisel J-N JN McDonnell J J JJ

Scientific reports 20190313 1

Records of δ<sup>18</sup>O in stream flow are critical for understanding and modeling hydrological, ecological, biogeochemical and atmospheric processes. However, the number of such records are extremely limited globally and the length of such time series are usually less than a decade. This situation severely handicaps their use in model testing and evaluation. Here we present a global assessment of freshwater mollusk (bivalves & gastropods) isotope data from 25 river basins that have stream wa ...[more]

PMID: 30867455

Similar Datasets

Project description:Ammonia oxidation regulates the balance of reduced and oxidized nitrogen pools in nature. Although ammonia-oxidizing archaea have been recently recognized to often outnumber ammonia-oxidizing bacteria in various environments, the contribution of ammonia-oxidizing archaea is still uncertain due to difficulties in the in situ quantification of ammonia oxidation activity. Nitrogen and oxygen isotope ratios of nitrite (?(15)NNO2- and ?(18)ONO2-, respectively) are geochemical tracers for evaluating the sources and the in situ rate of nitrite turnover determined from the activities of nitrification and denitrification; however, the isotope ratios of nitrite from archaeal ammonia oxidation have been characterized only for a few marine species. We first report the isotope effects of ammonia oxidation at 70°C by thermophilic Thaumarchaeota populations composed almost entirely of "Candidatus Nitrosocaldus." The nitrogen isotope effect of ammonia oxidation varied with ambient pH (25‰ to 32‰) and strongly suggests the oxidation of ammonia, not ammonium. The ?(18)O value of nitrite produced from ammonia oxidation varied with the ?(18)O value of water in the medium but was lower than the isotopic equilibrium value in water. Because experiments have shown that the half-life of abiotic oxygen isotope exchange between nitrite and water is longer than 33 h at 70°C and pH ?6.6, the rate of ammonia oxidation by thermophilic Thaumarchaeota could be estimated using ?(18)ONO2- in geothermal environments, where the biological nitrite turnover is likely faster than 33 h. This study extended the range of application of nitrite isotopes as a geochemical clock of the ammonia oxidation activity to high-temperature environments.Because ammonia oxidation is generally the rate-limiting step in nitrification that regulates the balance of reduced and oxidized nitrogen pools in nature, it is important to understand the biological and environmental factors underlying the regulation of the rate of ammonia oxidation. The discovery of ammonia-oxidizing archaea (AOA) in marine and terrestrial environments has transformed the concept that ammonia oxidation is operated only by bacterial species, suggesting that AOA play a significant role in the global nitrogen cycle. However, the archaeal contribution to ammonia oxidation in the global biosphere is not yet completely understood. This study successfully identified key factors controlling nitrogen and oxygen isotopic ratios of nitrite produced from thermophilic Thaumarchaeota and elucidated the applicability and its limit of nitrite isotopes as a geochemical clock of ammonia oxidation rate in nature. Oxygen isotope analysis in this study also provided new biochemical information on archaeal ammonia oxidation.

Project description:Antimicrobial peptides (AMPs) are biomolecules with antimicrobial activity against a broad group of pathogens. In the past few decades, AMPs have represented an important alternative for the treatment of infectious diseases. Their isolation from natural sources has been widely investigated. In this sense, mollusks are promising organisms for the identification of AMPs given that their immune system mainly relies on innate response. In this report, we characterized the peptide fraction of the Cuban freshwater snail Pomacea poeyana (Pilsbry, 1927) and identified 37 different peptides by nanoLC-ESI-MS-MS technology. From these peptide sequences, using bioinformatic prediction tools, we discovered two potential antimicrobial peptides named Pom-1 (KCAGSIAWAIGSGLFGGAKLIKIKKYIAELGGLQ) and Pom-2 (KEIERAGQRIRDAIISAAPAVETLAQAQKIIKGG). Database search revealed that Pom-1 is a fragment of Closticin 574 previously isolated from the bacteria Clostridium tyrobutyrium, and Pom-2 is a fragment of cecropin D-like peptide first isolated from Galleria mellonella hemolymph. These sequences were chemically synthesized and evaluated against different human pathogens. Interestingly, structural predictions of both peptides in the presence of micelles showed models that comprise two alpha helices joined by a short loop. The CD spectra analysis of Pom-1 and Pom-2 in water showed for both structures a high random coil content, a certain content of α-helix and a low β-sheet content. Like other described AMPs displaying a disordered structure in water, the peptides may adopt a helical conformation in presence of bacterial membranes. In antimicrobial assays, Pom-1 demonstrated high activity against the Gram-negative bacteria Pseudomonas aeruginosa and moderate activity against Klebsiella pneumoniae and Listeria monocytogenes. Neither of the two peptides showed antifungal action. Pom-1 moderately inhibits Zika Virus infection but slightly enhances HIV-1 infectivion in vitro. The evaluation of cell toxicity on primary human macrophages did not show toxicity on THP-1 cells, although slight overall toxicity was observed in high concentrations of Pom-1. We assume that both peptides may play a key role in innate defense of P. poeyana and represent promising antimicrobial candidates for humans.

Dataset Information

A global assessment of freshwater mollusk shell oxygen isotope signatures and their relation to precipitation and stream water.

Publications

A global assessment of freshwater mollusk shell oxygen isotope signatures and their relation to precipitation and stream water.

Similar Datasets

OmicsDI is part of the ELIXIR infrastructure